PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P11310_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 736aa    MW: 81179.5 Da    PI: 6.0839
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P11310_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665e-211671156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           +++ +++t+ q++eLe++F+ +++p++++r++L++ lgL+ rq+k+WFqNrR+++k
  GSMUA_Achr7P11310_001 16 KKRYHRHTPRQIQELESMFKVCPHPDEKQRAQLSRDLGLEPRQIKFWFQNRRTQMK 71
                           688999***********************************************998 PP

2START172.92e-542194413206
                            HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                  START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                            a  a++e++++++a++p+Wvks     ++++ +++ ++f++s+        ++ea+r+s++v+m++++l   ++d + +W e ++   
  GSMUA_Achr7P11310_001 219 ATGAMEEVIRLVQADAPLWVKSGsdgrDILQLETYDRIFQRSNRqlrfpdTQTEASRDSALVFMNATTLIDMFMDAS-KWAELFPtiv 305
                            6679******************999999999999999999988899****9**************************.*****99999 PP

                            .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEE CS
                  START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepk 157
                             ka t ev+  g      g l lm+ elq+lsp+vp R+f f+Ry++q + ++w+++dvSvd +++++      R+++lpSg+lie++
  GSMUA_Achr7P11310_001 306 sKARTFEVLAAGmagsrsGSLILMYEELQVLSPVVPtREFCFLRYCQQIEPHVWAVADVSVDYPRDNQL--APSRSRKLPSGCLIEEM 391
                            9*****************************************************************986..556889*********** PP

                            CTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                  START 158 snghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                            sng+sk+twveh++ +++ p h l+r l++sg+a+ga++w+ tlqr ce+
  GSMUA_Achr7P11310_001 392 SNGYSKITWVEHMEIEEKNPiHILFRDLINSGMAFGAQRWLTTLQRMCER 441
                            ************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-22472IPR009057Homeodomain-like
SuperFamilySSF466896.68E-20772IPR009057Homeodomain-like
PROSITE profilePS5007117.3621373IPR001356Homeobox domain
SMARTSM003899.0E-201477IPR001356Homeobox domain
CDDcd000865.35E-191571No hitNo description
PfamPF000461.5E-181671IPR001356Homeobox domain
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PROSITE profilePS5084850.92208444IPR002913START domain
SuperFamilySSF559616.14E-35210442No hitNo description
CDDcd088754.76E-111212440No hitNo description
SMARTSM002346.0E-46217441IPR002913START domain
PfamPF018524.8E-46221441IPR002913START domain
Gene3DG3DSA:3.30.530.201.0E-6281440IPR023393START-like domain
SuperFamilySSF559613.96E-22460713No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MDSGDEQDVP DSQGRKKRYH RHTPRQIQEL ESMFKVCPHP DEKQRAQLSR DLGLEPRQIK  60
FWFQNRRTQM KATARRSLLA DNCLLRAEND KIRCENIAMR EAMKNVICPS CGAPPASDDS  120
YFDEQKLRME NARLKEEVTS TSLSSNLFVG GDPSRVDDYI RCHQSTLVVL DRVSSLASKY  180
LGRPITQLPP VQPLSVSSLD LSVGGYISEL EKPLMMEMAT GAMEEVIRLV QADAPLWVKS  240
GSDGRDILQL ETYDRIFQRS NRQLRFPDTQ TEASRDSALV FMNATTLIDM FMDASKWAEL  300
FPTIVSKART FEVLAAGMAG SRSGSLILMY EELQVLSPVV PTREFCFLRY CQQIEPHVWA  360
VADVSVDYPR DNQLAPSRSR KLPSGCLIEE MSNGYSKITW VEHMEIEEKN PIHILFRDLI  420
NSGMAFGAQR WLTTLQRMCE RFACLTITGL PARDLGVTPT PDGKKSMMKL AQRMVNNFCA  480
NVGAANGHKW TTLSGLNDVG VRVTLHKSTD AGQPNGVVLS AATSIWLPIS TERVFSFFKD  540
EQTRTQWDVL ANGNTVQEVA HITNGSHPGN CISLLLCLPA PIIFSFHIFH EFVCFGLNSG  600
QNTMLILQEC CTDASGSVVV YSPIDLPAIN IVMSGEDPSY VPILPSGFTI LPDGRSAGGQ  660
GASSSSNPLG GSSGSLVTVA FQILMSSLPS AKLNLESVTT VNNLIGTTVQ QIKAALNSSG  720
NGSVMQSNEL DDAAQS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409108.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLM0TGL90.0M0TGL9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P11310_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11